SCOPe 2.08: Domain d2puya1: 2puy A:486-543

Lineage for d2puya1 (2puy A:486-543)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.0: automated matches [191482] (1 protein)
   not a true family

6. Protein automated matches [190772] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187998] (28 PDB entries)

8. Domain d2puya1: 2puy A:486-543 [167278]
   Other proteins in same PDB: d2puya2, d2puyb2
   automated match to d1mm2a_
   complexed with zn

Details for d2puya1

PDB Entry: 2puy, 1.43 Å

PDB Description: Crystal Structure of the BHC80 PHD finger

PDB Compounds: (A:) PHD finger protein 21A

SCOPe Domain Sequences for d2puya1:

Sequence; same for both SEQRES and ATOM records:

>d2puya1 g.50.1.0 (A:486-543) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ihedfcsvcrksgqllmcdtcsrvyhldcldpplktipkgmwicprcqdqmlkkeeai

Timeline for d2puya1:

• d2puya1 first appeared in SCOPe 2.01, called d2puya_
  
• d2puya1 appears in SCOPe 2.07