Lineage for d2puyb1 (2puy B:486-543)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037862Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 3037863Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 3037962Family g.50.1.0: automated matches [191482] (1 protein)
    not a true family
  6. 3037963Protein automated matches [190772] (6 species)
    not a true protein
  7. 3037968Species Human (Homo sapiens) [TaxId:9606] [187998] (28 PDB entries)
  8. 3037972Domain d2puyb1: 2puy B:486-543 [167279]
    Other proteins in same PDB: d2puya2, d2puyb2
    automated match to d1mm2a_
    complexed with zn

Details for d2puyb1

PDB Entry: 2puy (more details), 1.43 Å

PDB Description: Crystal Structure of the BHC80 PHD finger
PDB Compounds: (B:) PHD finger protein 21A

SCOPe Domain Sequences for d2puyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2puyb1 g.50.1.0 (B:486-543) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ihedfcsvcrksgqllmcdtcsrvyhldcldpplktipkgmwicprcqdqmlkkeeai

SCOPe Domain Coordinates for d2puyb1:

Click to download the PDB-style file with coordinates for d2puyb1.
(The format of our PDB-style files is described here.)

Timeline for d2puyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2puyb2