Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1dpsh_ (1dps H:)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. Protein Dodecameric ferritin homolog [47250] (14 species)
  7. Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries)
    ferritin homolog that binds to and protects DNA
  8. Domain d1dpsh_: 1dps H: [16723]
    complexed with na

Details for d1dpsh_

PDB Entry: 1dps (more details)
PDB Description: the crystal structure of dps, a ferritin homolog that binds and protects dna
PDB Compounds: (H:) dps

SCOP Domain Sequences for d1dpsh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dpsh_ a.25.1.1 (H:) Dodecameric ferritin homolog {Escherichia coli, Dps [TaxId: 562]}
llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
kaigeakdddtadiltaasrdldkflwfiecnie

SCOP Domain Coordinates for d1dpsh_:

Click to download the PDB-style file with coordinates for d1dpsh_.
(The format of our PDB-style files is described here.)

Timeline for d1dpsh_:

d1dpsh_ appears in SCOP 1.75A


d1dpsh_
(click for larger image)


d1dpsh_ in context of chain



d1dpsh_ in context of PDB
Domains from other chains:
d1dpsa_, d1dpsb_, d1dpsc_, d1dpsd_, d1dpse_, d1dpsf_, d1dpsg_, d1dpsi_, d1dpsj_, d1dpsk_, d1dpsl_


SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu