Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins) |
Protein automated matches [190078] (5 species) not a true protein |
Species Plasmodium vivax [TaxId:5855] [187988] (4 PDB entries) |
Domain d2pgfa_: 2pgf A: [167177] automated match to d2amxa1 complexed with adn, ccn, zn |
PDB Entry: 2pgf (more details), 1.89 Å
SCOPe Domain Sequences for d2pgfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pgfa_ c.1.9.1 (A:) automated matches {Plasmodium vivax [TaxId: 5855]} qepidflkkeelknidlsqmskkerykiwkripkcelhchldlcfsadffvscirkynlq pnlsdeevldyylfakggkslgefvekaikvadifhdyeviedlakhavfnkykegvvlm efrysptfvafkynldielihqaivkgikevvelldhkihvalmcigdtgheaanikasa dfclkhkadfvgfdhgghevdlkeykeifdyvresgvplsvhagedvtlpnlntlysaiq vlkverighgirvaesqelidmvkeknillevcpisnvllknaksmdthpirqlydagvk vsvnsddpgmfltninddyeelythlnftledfmkmnewaleksfmdsnikdkiknlyf
Timeline for d2pgfa_: