Lineage for d2pgfa_ (2pgf A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2084338Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2084339Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 protein domains)
  6. 2084387Protein automated matches [190078] (4 species)
    not a true protein
  7. 2084396Species Plasmodium vivax [TaxId:5855] [187988] (4 PDB entries)
  8. 2084397Domain d2pgfa_: 2pgf A: [167177]
    automated match to d2amxa1
    complexed with adn, ccn, zn

Details for d2pgfa_

PDB Entry: 2pgf (more details), 1.89 Å

PDB Description: Crystal structure of adenosine deaminase from Plasmodium vivax in complex with adenosine
PDB Compounds: (A:) adenosine deaminase

SCOPe Domain Sequences for d2pgfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pgfa_ c.1.9.1 (A:) automated matches {Plasmodium vivax [TaxId: 5855]}
qepidflkkeelknidlsqmskkerykiwkripkcelhchldlcfsadffvscirkynlq
pnlsdeevldyylfakggkslgefvekaikvadifhdyeviedlakhavfnkykegvvlm
efrysptfvafkynldielihqaivkgikevvelldhkihvalmcigdtgheaanikasa
dfclkhkadfvgfdhgghevdlkeykeifdyvresgvplsvhagedvtlpnlntlysaiq
vlkverighgirvaesqelidmvkeknillevcpisnvllknaksmdthpirqlydagvk
vsvnsddpgmfltninddyeelythlnftledfmkmnewaleksfmdsnikdkiknlyf

SCOPe Domain Coordinates for d2pgfa_:

Click to download the PDB-style file with coordinates for d2pgfa_.
(The format of our PDB-style files is described here.)

Timeline for d2pgfa_: