SCOPe 2.05: Domain d2pcxa_: 2pcx A:

Lineage for d2pcxa_ (2pcx A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49420] (34 PDB entries)

8. Domain d2pcxa_: 2pcx A: [167134]
   automated match to d1gzha_
   complexed with zn

Details for d2pcxa_

PDB Entry: 2pcx, 1.54 Å

PDB Description: Crystal structure of p53DBD(R282Q) at 1.54-angstrom Resolution

PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d2pcxa_:

Sequence; same for both SEQRES and ATOM records:

>d2pcxa_ b.2.5.2 (A:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
hhhhhhsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwv
dstpppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveyld
drntfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgr
nsfevrvcacpgrdqrteeenlrkk

Timeline for d2pcxa_:

• d2pcxa_ first appeared in SCOPe 2.01
  
• d2pcxa_ appears in SCOPe 2.04
  
• d2pcxa_ is called d2pcxa1 in SCOPe 2.06
  
• d2pcxa_ appears in the current release, SCOPe 2.08, called d2pcxa1