Lineage for d2pcxa_ (2pcx A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 938438Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 938790Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 938791Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 938792Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 938793Species Human (Homo sapiens) [TaxId:9606] [49420] (23 PDB entries)
  8. 938796Domain d2pcxa_: 2pcx A: [167134]
    automated match to d1gzha_
    complexed with zn

Details for d2pcxa_

PDB Entry: 2pcx (more details), 1.54 Å

PDB Description: Crystal structure of p53DBD(R282Q) at 1.54-angstrom Resolution
PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d2pcxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pcxa_ b.2.5.2 (A:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
hhhhhhsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwv
dstpppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveyld
drntfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgr
nsfevrvcacpgrdqrteeenlrkk

SCOPe Domain Coordinates for d2pcxa_:

Click to download the PDB-style file with coordinates for d2pcxa_.
(The format of our PDB-style files is described here.)

Timeline for d2pcxa_: