Lineage for d2pcxa1 (2pcx A:94-292)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767925Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2767926Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 2767927Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 2767928Species Human (Homo sapiens) [TaxId:9606] [49420] (71 PDB entries)
  8. 2767938Domain d2pcxa1: 2pcx A:94-292 [167134]
    Other proteins in same PDB: d2pcxa2
    automated match to d1gzha_
    complexed with zn

Details for d2pcxa1

PDB Entry: 2pcx (more details), 1.54 Å

PDB Description: Crystal structure of p53DBD(R282Q) at 1.54-angstrom Resolution
PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d2pcxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pcxa1 b.2.5.2 (A:94-292) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstppp
gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfr
hsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevr
vcacpgrdqrteeenlrkk

SCOPe Domain Coordinates for d2pcxa1:

Click to download the PDB-style file with coordinates for d2pcxa1.
(The format of our PDB-style files is described here.)

Timeline for d2pcxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pcxa2