| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) ![]() |
| Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins) |
| Protein automated matches [190196] (7 species) not a true protein |
| Species Thermus thermophilus [TaxId:274] [187977] (7 PDB entries) |
| Domain d2p30a_: 2p30 A: [166981] automated match to d1v37a_ |
PDB Entry: 2p30 (more details), 1.85 Å
SCOPe Domain Sequences for d2p30a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p30a_ c.60.1.1 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtae
lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf
leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlamdgeeatg
Timeline for d2p30a_: