SCOPe 2.01: Domain d2p30a_: 2p30 A:

Lineage for d2p30a_ (2p30 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families)

5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)

6. Protein automated matches [190196] (7 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [187977] (7 PDB entries)

8. Domain d2p30a_: 2p30 A: [166981]
   automated match to d1v37a_

Details for d2p30a_

PDB Entry: 2p30, 1.85 Å

PDB Description: crystal structure of tthb049 from thermus thermophilus hb8

PDB Compounds: (A:) Alpha-ribazole-5'-phosphate phosphatase

SCOPe Domain Sequences for d2p30a_:

Sequence; same for both SEQRES and ATOM records:

>d2p30a_ c.60.1.1 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtae
lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf
leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlamdgeeatg

Timeline for d2p30a_:

• d2p30a_ is new in SCOPe 2.01-stable
  
• d2p30a_ appears in SCOPe 2.02
  
• d2p30a_ appears in the current release, SCOPe 2.08