SCOPe 2.01: Domain d2os3a_: 2os3 A:

Lineage for d2os3a_ (2os3 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)

6. Protein Peptide deformylase [56422] (10 species)

7. Species Streptococcus pyogenes [TaxId:160490] [188359] (1 PDB entry)

8. Domain d2os3a_: 2os3 A: [166836]
   automated match to d1lm6a_
   complexed with bb2, co

Details for d2os3a_

PDB Entry: 2os3, 2.26 Å

PDB Description: Structures of actinonin bound peptide deformylases from E. faecalis and S. pyogenes

PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d2os3a_:

Sequence; same for both SEQRES and ATOM records:

>d2os3a_ d.167.1.1 (A:) Peptide deformylase {Streptococcus pyogenes [TaxId: 160490]}
saqdklikpshlitmddiiregnptlravakevslplcdedillgekmmqflkhsqdpvm
aeklglragvglaapqidvskriiavlvpnlpdkegnppkeayswqevlynpkivshsvq
daalsdgegclsvdrvvegyvvrharvtvdyydkegqqhriklkgynaivvqheidhing
vlfydrinaknpfetkeellildle

Timeline for d2os3a_:

• d2os3a_ is new in SCOPe 2.01-stable
  
• d2os3a_ appears in SCOPe 2.02
  
• d2os3a_ appears in the current release, SCOPe 2.08, called d2os3a1