PDB entry 2os3

View 2os3 on RCSB PDB site
Description: Structures of actinonin bound peptide deformylases from E. faecalis and S. pyogenes
Class: hydrolase
Keywords: PDF, peptide deformylase, HYDROLASE
Deposited on 2007-02-05, released 2008-03-04
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.205
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide deformylase
    Species: Streptococcus pyogenes M1 GAS [TaxId:160490]
    Gene: def
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68771 (0-202)
      • expression tag (203-204)
    Domains in SCOPe 2.01: d2os3a_
  • Heterogens: CO, BB2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2os3A (A:)
saqdklikpshlitmddiiregnptlravakevslplcdedillgekmmqflkhsqdpvm
aeklglragvglaapqidvskriiavlvpnlpdkegnppkeayswqevlynpkivshsvq
daalsdgegclsvdrvvegyvvrharvtvdyydkegqqhriklkgynaivvqheidhing
vlfydrinaknpfetkeellildle