Lineage for d2ol0a_ (2ol0 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818071Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2818072Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 2818142Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 2818204Species Vaccinia virus [TaxId:10245] [187961] (5 PDB entries)
  8. 2818208Domain d2ol0a_: 2ol0 A: [166753]
    automated match to d1q5hb_
    complexed with cl, dud, edo, mg

Details for d2ol0a_

PDB Entry: 2ol0 (more details), 2.1 Å

PDB Description: high resolution crystal structures of vaccinia virus dutpase
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d2ol0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ol0a_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Vaccinia virus [TaxId: 10245]}
spvrfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpkfcygria
prsglslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqriyypelee
vqsl

SCOPe Domain Coordinates for d2ol0a_:

Click to download the PDB-style file with coordinates for d2ol0a_.
(The format of our PDB-style files is described here.)

Timeline for d2ol0a_: