PDB entry 2ol0

View 2ol0 on RCSB PDB site
Description: High Resolution Crystal Structures of Vaccinia Virus dUTPase
Class: hydrolase
Keywords: Fold, jelly-roll, Superfamily, dUTPase-like, forms tight trimer through an additional beta-sheet in each subunit, subunit beta-sheets are orthogonally packed around the three-fold axis, HYDROLASE
Deposited on 2007-01-18, released 2007-05-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.209
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Vaccinia virus [TaxId:10245]
    Gene: dut
    Database cross-references and differences (RAF-indexed):
    • GB AAO89320
      • engineered (27)
    Domains in SCOPe 2.06: d2ol0a_
  • Chain 'B':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Vaccinia virus [TaxId:10245]
    Gene: dut
    Database cross-references and differences (RAF-indexed):
    • GB AAO89320
      • engineered (27)
    Domains in SCOPe 2.06: d2ol0b_
  • Chain 'C':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Vaccinia virus [TaxId:10245]
    Gene: dut
    Database cross-references and differences (RAF-indexed):
    • GB AAO89320
      • engineered (27)
    Domains in SCOPe 2.06: d2ol0c_
  • Heterogens: CL, MG, DUD, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ol0A (A:)
    mfnmninspvrfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpk
    fcygriaprsglslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqri
    yypeleevqsldstnrgdqgfgstglr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ol0A (A:)
    spvrfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpkfcygria
    prsglslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqriyypelee
    vqsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ol0B (B:)
    mfnmninspvrfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpk
    fcygriaprsglslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqri
    yypeleevqsldstnrgdqgfgstglr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ol0B (B:)
    spvrfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpkfcygria
    prsglslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqriyypelee
    vqsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ol0C (C:)
    mfnmninspvrfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpk
    fcygriaprsglslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqri
    yypeleevqsldstnrgdqgfgstglr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ol0C (C:)
    nspvrfvketnraksptrqspgaagydlysaydytippgerqliktdismsmpkfcygri
    aprsglslkgidigggvidedyrgnigvilinngkctfnvntgdriaqliyqriyypele
    evqsl