SCOPe 2.03: Domain d2ofca_: 2ofc A:

Lineage for d2ofca_ (2ofc A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
   sandwich, 10 strands in 2 sheets;

4. Superfamily b.97.1: Cytolysin/lectin [63724] (2 families)
   some topological similarity to osmotin

5. Family b.97.1.2: Fungal fruit body lectin [117119] (3 proteins)
   Pfam PF07367

6. Protein automated matches [190758] (3 species)
   not a true protein

7. Species Athelia rolfsii [TaxId:39291] [187957] (3 PDB entries)

8. Domain d2ofca_: 2ofc A: [166674]
   automated match to d1y2ta_
   complexed with act, mpd, trs

Details for d2ofca_

PDB Entry: 2ofc, 1.11 Å

PDB Description: The crystal structure of Sclerotium rolfsii lectin

PDB Compounds: (A:) Sclerotium rolfsii lectin

SCOPe Domain Sequences for d2ofca_:

Sequence; same for both SEQRES and ATOM records:

>d2ofca_ b.97.1.2 (A:) automated matches {Athelia rolfsii [TaxId: 39291]}
tykitvrvyqtnpnaffhpvektvwkyanggtwtitddqhvltmggsgtsgtlrfhadng
esftatfgvhnykrwcdivtnlaadetgmvinqqyysqknreearerqlsnyevknakgr
nfeivyteaegndlhanliig

Timeline for d2ofca_:

• d2ofca_ first appeared in SCOPe 2.01
  
• d2ofca_ appears in SCOPe 2.02
  
• d2ofca_ appears in SCOPe 2.04
  
• d2ofca_ appears in the current release, SCOPe 2.08