Lineage for d2ofca_ (2ofc A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408952Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
    sandwich, 10 strands in 2 sheets;
  4. 2408953Superfamily b.97.1: Cytolysin/lectin [63724] (2 families) (S)
    some topological similarity to osmotin
  5. 2408975Family b.97.1.2: Fungal fruit body lectin [117119] (3 proteins)
    Pfam PF07367
  6. 2408994Protein automated matches [190758] (3 species)
    not a true protein
  7. 2408995Species Athelia rolfsii [TaxId:39291] [187957] (7 PDB entries)
  8. 2408996Domain d2ofca_: 2ofc A: [166674]
    automated match to d1y2ta_
    complexed with act, mpd, trs

Details for d2ofca_

PDB Entry: 2ofc (more details), 1.11 Å

PDB Description: The crystal structure of Sclerotium rolfsii lectin
PDB Compounds: (A:) Sclerotium rolfsii lectin

SCOPe Domain Sequences for d2ofca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ofca_ b.97.1.2 (A:) automated matches {Athelia rolfsii [TaxId: 39291]}
tykitvrvyqtnpnaffhpvektvwkyanggtwtitddqhvltmggsgtsgtlrfhadng
esftatfgvhnykrwcdivtnlaadetgmvinqqyysqknreearerqlsnyevknakgr
nfeivyteaegndlhanliig

SCOPe Domain Coordinates for d2ofca_:

Click to download the PDB-style file with coordinates for d2ofca_.
(The format of our PDB-style files is described here.)

Timeline for d2ofca_: