| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein automated matches [190043] (8 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [187080] (10 PDB entries) |
| Domain d2oawc_: 2oaw C: [166606] automated match to d1bk2a_ complexed with cl |
PDB Entry: 2oaw (more details), 1.9 Å
SCOPe Domain Sequences for d2oawc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oawc_ b.34.2.1 (C:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevkitvngktyerqgfvpaay
vkkld
Timeline for d2oawc_: