Lineage for d2o1mb_ (2o1m B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1185373Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1185374Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1186385Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1186386Protein automated matches [190039] (34 species)
    not a true protein
  7. 1186389Species Bacillus subtilis [TaxId:1423] [187940] (2 PDB entries)
  8. 1186391Domain d2o1mb_: 2o1m B: [166494]
    automated match to d1ggga_
    complexed with so4

Details for d2o1mb_

PDB Entry: 2o1m (more details), 2 Å

PDB Description: crystal structure of the probable amino-acid abc transporter extracellular-binding protein ytmk from bacillus subtilis. northeast structural genomics consortium target sr572
PDB Compounds: (B:) Probable amino-acid ABC transporter extracellular-binding protein ytmK

SCOPe Domain Sequences for d2o1mb_:

Sequence, based on SEQRES records: (download)

>d2o1mb_ c.94.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
kvqtitvgtgtqfpnicfidekgdltgydvelikeldkrlphykftfktmefsnllvslg
qhkvdivahqmekskerekkflfnkvaynhfplkitvlqnndtirgiedlkgkrvitsat
sngalvlkkwnedngrpfeiayegqganetanqlksgradatistpfavdfqnktstike
ktvgnvlsnakvyfmfnkneqtlsddidkalqeiiddgtlkrlslkwlgd

Sequence, based on observed residues (ATOM records): (download)

>d2o1mb_ c.94.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
kvqtitvgtgtqfpnicfidekgdltgydvelikeldkrlphykftfktmefsnllvslg
qhkvdivahqmekskerekkflfnkvaynhfplkitvlqnndtirgiedlkgkrvitsag
alvlkkwnedngrpfeiayeanetanqlksgradatistpfavdfqnktstikektvgnv
lsnakvyfmfnkneqtlsddidkalqeiiddgtlkrlslkwlgd

SCOPe Domain Coordinates for d2o1mb_:

Click to download the PDB-style file with coordinates for d2o1mb_.
(The format of our PDB-style files is described here.)

Timeline for d2o1mb_: