SCOPe 2.02: Domain d2o1ma_: 2o1m A:

Lineage for d2o1ma_ (2o1m A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (34 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [187940] (2 PDB entries)

8. Domain d2o1ma_: 2o1m A: [166493]
   automated match to d1ggga_
   complexed with so4

Details for d2o1ma_

PDB Entry: 2o1m, 2 Å

PDB Description: crystal structure of the probable amino-acid abc transporter extracellular-binding protein ytmk from bacillus subtilis. northeast structural genomics consortium target sr572

PDB Compounds: (A:) Probable amino-acid ABC transporter extracellular-binding protein ytmK

SCOPe Domain Sequences for d2o1ma_:

Sequence; same for both SEQRES and ATOM records:

>d2o1ma_ c.94.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
kvqtitvgtgtqfpnicfidekgdltgydvelikeldkrlphykftfktmefsnllvslg
qhkvdivahqmekskerekkflfnkvaynhfplkitvlqnndtirgiedlkgkrvitsat
sngalvlkkwnedngrpfeiayegqganetanqlksgradatistpfavdfqnktstike
ktvgnvlsnakvyfmfnkneqtlsddidkalqeiiddgtlkrlslkwlgddy

Timeline for d2o1ma_:

• d2o1ma_ first appeared in SCOPe 2.01
  
• d2o1ma_ appears in SCOPe 2.03
  
• d2o1ma_ appears in the current release, SCOPe 2.08