Lineage for d2nuxa_ (2nux A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1147695Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1148735Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1148736Protein automated matches [190115] (32 species)
    not a true protein
  7. 1148935Species Sulfolobus acidocaldarius [TaxId:330779] [187925] (3 PDB entries)
  8. 1148940Domain d2nuxa_: 2nux A: [166364]
    automated match to d1w37a_
    complexed with mg

Details for d2nuxa_

PDB Entry: 2nux (more details), 2.5 Å

PDB Description: 2-keto-3-deoxygluconate aldolase from sulfolobus acidocaldarius, native structure in p6522 at 2.5 a resolution
PDB Compounds: (A:) 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho gluconate aldolase

SCOPe Domain Sequences for d2nuxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nuxa_ c.1.10.0 (A:) automated matches {Sulfolobus acidocaldarius [TaxId: 330779]}
meiispiitpfdkqgkvnvdalkthaknllekgidaifvngttglgpalskdekrqnlna
lydvthklifqvgslnlndvmelvkfsnemdilgvsshspyyfprlpekflakyyeeiar
isshslyiynypaatgydippsilkslpvkgikdtnqdlahsleyklnlpgvkvyngsnt
liyysllsldgvvasftnfipevivkqrdlikqgklddalrlqelinrladilrkygsis
aiyvlvnefqgydvgyprppifpltdeealslkreieplkrkiqelvh

SCOPe Domain Coordinates for d2nuxa_:

Click to download the PDB-style file with coordinates for d2nuxa_.
(The format of our PDB-style files is described here.)

Timeline for d2nuxa_: