Lineage for d2kkda_ (2kkd A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641212Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2641213Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 2641222Protein Rubredoxin [57804] (8 species)
  7. 2641263Species Desulfovibrio vulgaris [TaxId:881] [57805] (8 PDB entries)
  8. 2641272Domain d2kkda_: 2kkd A: [166260]
    automated match to d1rb9a_
    complexed with ni

Details for d2kkda_

PDB Entry: 2kkd (more details)

PDB Description: nmr structure of ni substitued desulfovibrio vulgaris rubredoxin
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d2kkda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kkda_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio vulgaris [TaxId: 881]}
mkkyvctvcgyeydpaegdpdngvkpgtsfddlpadwvcpvcgapksefeaa

SCOPe Domain Coordinates for d2kkda_:

Click to download the PDB-style file with coordinates for d2kkda_.
(The format of our PDB-style files is described here.)

Timeline for d2kkda_: