Lineage for d2kkda1 (2kkd A:1-52)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065992Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1066160Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 1066161Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1066170Protein Rubredoxin [57804] (8 species)
  7. 1066208Species Desulfovibrio vulgaris [TaxId:881] [57805] (7 PDB entries)
  8. 1066217Domain d2kkda1: 2kkd A:1-52 [166260]
    automatically matched to d1rb9a_
    complexed with ni

Details for d2kkda1

PDB Entry: 2kkd (more details)

PDB Description: nmr structure of ni substitued desulfovibrio vulgaris rubredoxin
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d2kkda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kkda1 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio vulgaris [TaxId: 881]}
mkkyvctvcgyeydpaegdpdngvkpgtsfddlpadwvcpvcgapksefeaa

SCOPe Domain Coordinates for d2kkda1:

Click to download the PDB-style file with coordinates for d2kkda1.
(The format of our PDB-style files is described here.)

Timeline for d2kkda1: