Class b: All beta proteins [48724] (176 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
Protein automated matches [190436] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187333] (75 PDB entries) |
Domain d2jina_: 2jin A: [166211] automated match to d1qlca_ complexed with na, so4 |
PDB Entry: 2jin (more details), 1.5 Å
SCOPe Domain Sequences for d2jina_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jina_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} smrvdylvteeeinltrgpsglgfnivggtdqqyvsndsgiyvsrikengaaaldgrlqe gdkilsvngqdlknllhqdavdlfrnagyavslrvqhressi
Timeline for d2jina_: