SCOPe 2.08: Domain d2jina1: 2jin A:4-99

Lineage for d2jina1 (2jin A:4-99)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries)

8. Domain d2jina1: 2jin A:4-99 [166211]
   Other proteins in same PDB: d2jina2, d2jina3
   automated match to d1qlca_
   complexed with na, so4

Details for d2jina1

PDB Entry: 2jin, 1.5 Å

PDB Description: crystal structure of pdz domain of synaptojanin-2 binding protein

PDB Compounds: (A:) synaptojanin-2 binding protein

SCOPe Domain Sequences for d2jina1:

Sequence; same for both SEQRES and ATOM records:

>d2jina1 b.36.1.0 (A:4-99) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvdylvteeeinltrgpsglgfnivggtdqqyvsndsgiyvsrikengaaaldgrlqegd
kilsvngqdlknllhqdavdlfrnagyavslrvqhr

Timeline for d2jina1:

• d2jina1 first appeared in SCOPe 2.01, called d2jina_
  
• d2jina1 was called d2jina_ in SCOPe 2.07