Lineage for d1fapb_ (1fap B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2313347Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family) (S)
    automatically mapped to Pfam PF08771
  5. 2313348Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (2 proteins)
  6. 2313349Protein mTOR FKBP12–rapamycin-binding (FRB) domain [47214] (1 species)
  7. 2313350Species Human (Homo sapiens) [TaxId:9606] [47215] (11 PDB entries)
  8. 2313360Domain d1fapb_: 1fap B: [16618]
    Other proteins in same PDB: d1fapa_
    complexed with rap

Details for d1fapb_

PDB Entry: 1fap (more details), 2.7 Å

PDB Description: the structure of the immunophilin-immunosuppressant fkbp12-rapamycin complex interacting with human frap
PDB Compounds: (B:) frap

SCOPe Domain Sequences for d1fapb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fapb_ a.24.7.1 (B:) mTOR FKBP12–rapamycin-binding (FRB) domain {Human (Homo sapiens) [TaxId: 9606]}
rvailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrd
lmeaqewcrkymksgnvkdltqawdlyyhvfrris

SCOPe Domain Coordinates for d1fapb_:

Click to download the PDB-style file with coordinates for d1fapb_.
(The format of our PDB-style files is described here.)

Timeline for d1fapb_: