Lineage for d2fapb_ (2fap B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1083284Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1083576Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family) (S)
  5. 1083577Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (2 proteins)
  6. 1083578Protein FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47214] (1 species)
  7. 1083579Species Human (Homo sapiens) [TaxId:9606] [47215] (7 PDB entries)
  8. 1083582Domain d2fapb_: 2fap B: [16614]
    Other proteins in same PDB: d2fapa_
    complexed with rad

Details for d2fapb_

PDB Entry: 2fap (more details), 2.2 Å

PDB Description: the structure of the immunophilin-immunosuppressant fkbp12-(c16)-ethoxy rapamycin complex interacting with huma
PDB Compounds: (B:) frap

SCOPe Domain Sequences for d2fapb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fapb_ a.24.7.1 (B:) FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) {Human (Homo sapiens) [TaxId: 9606]}
vailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdl
meaqewcrkymksgnvkdltqawdlyyhvfrris

SCOPe Domain Coordinates for d2fapb_:

Click to download the PDB-style file with coordinates for d2fapb_.
(The format of our PDB-style files is described here.)

Timeline for d2fapb_: