| Class a: All alpha proteins [46456] (138 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (11 superfamilies) |
Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family) ![]() |
| Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (1 protein) |
| Protein FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47214] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47215] (6 PDB entries) |
| Domain d2fapb_: 2fap B: [16614] Other proteins in same PDB: d2fapa_ |
PDB Entry: 2fap (more details), 2.2 Å
SCOP Domain Sequences for d2fapb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fapb_ a.24.7.1 (B:) FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) {Human (Homo sapiens)}
vailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdl
meaqewcrkymksgnvkdltqawdlyyhvfrris
Timeline for d2fapb_: