Lineage for d2jc3f_ (2jc3 F:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1387142Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1387143Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1387144Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 1387367Protein automated matches [190054] (8 species)
    not a true protein
  7. 1387386Species Salmonella typhimurium [TaxId:90371] [189633] (14 PDB entries)
  8. 1387405Domain d2jc3f_: 2jc3 F: [166000]
    automated match to d2bhsa1
    complexed with plp

Details for d2jc3f_

PDB Entry: 2jc3 (more details), 2.3 Å

PDB Description: structure of o-acetylserine sulfhydrylase b from salmonella typhimurium
PDB Compounds: (F:) o-acetylserine sulfhydrylase b

SCOPe Domain Sequences for d2jc3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jc3f_ c.79.1.1 (F:) automated matches {Salmonella typhimurium [TaxId: 90371]}
mntleqtigntplvklqrigpdngseiwvklegnnpagsvkdraalsmiveaekrgeikp
gdvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgme
gardlalamsergegklldqfnnpdnpyahytttgpeiwrqtsgrithfvssmgttgtit
gvsrflreqekpvtivglqpeegssipgirrwpaeympgifnaslvdevldihqndaent
mrelavregifcgvssggavagalrvaratpgaivvaiicdrgdrylstgvfge

SCOPe Domain Coordinates for d2jc3f_:

Click to download the PDB-style file with coordinates for d2jc3f_.
(The format of our PDB-style files is described here.)

Timeline for d2jc3f_: