Lineage for d2bhsa1 (2bhs A:2-293)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1387142Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1387143Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1387144Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 1387247Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)
  7. 1387251Species Escherichia coli, isoform B (CysM) [TaxId:562] [142744] (2 PDB entries)
    Uniprot P16703 2-293
  8. 1387253Domain d2bhsa1: 2bhs A:2-293 [128546]
    Other proteins in same PDB: d2bhsb_, d2bhsc_, d2bhsd_
    complexed with plp

Details for d2bhsa1

PDB Entry: 2bhs (more details), 2.67 Å

PDB Description: crystal structure of cysteine synthase b
PDB Compounds: (A:) Cysteine synthase B

SCOPe Domain Sequences for d2bhsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]}
stleqtigntplvklqrmgpdngsevwlklegnnpagsvkdraalsmiveaekrgeikpg
dvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgmeg
ardlalemanrgegklldqfnnpdnpyahytttgpeiwqqtggrithfvssmgttgtitg
vsrfmreqskpvtivglqpeegssipgirrwpteylpgifnaslvdevldihqrdaentm
relavregifcgvssggavagalrvakanpdavvvaiicdrgdrylstgvfg

SCOPe Domain Coordinates for d2bhsa1:

Click to download the PDB-style file with coordinates for d2bhsa1.
(The format of our PDB-style files is described here.)

Timeline for d2bhsa1: