| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) ![]() |
| Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) |
| Protein automated matches [190054] (13 species) not a true protein |
| Species Salmonella typhimurium [TaxId:90371] [189633] (15 PDB entries) |
| Domain d2jc3f_: 2jc3 F: [166000] automated match to d2bhsa1 complexed with plp |
PDB Entry: 2jc3 (more details), 2.3 Å
SCOPe Domain Sequences for d2jc3f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jc3f_ c.79.1.1 (F:) automated matches {Salmonella typhimurium [TaxId: 90371]}
mntleqtigntplvklqrigpdngseiwvklegnnpagsvkdraalsmiveaekrgeikp
gdvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgme
gardlalamsergegklldqfnnpdnpyahytttgpeiwrqtsgrithfvssmgttgtit
gvsrflreqekpvtivglqpeegssipgirrwpaeympgifnaslvdevldihqndaent
mrelavregifcgvssggavagalrvaratpgaivvaiicdrgdrylstgvfge
Timeline for d2jc3f_: