Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (79 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [187532] (4 PDB entries) |
Domain d2j41a_: 2j41 A: [165860] automated match to d1s96a_ complexed with 5gp, k, so4 |
PDB Entry: 2j41 (more details), 1.9 Å
SCOPe Domain Sequences for d2j41a_:
Sequence, based on SEQRES records: (download)
>d2j41a_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} ekgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyffktrdaf ealikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfpdalfif lappslehlrerlvgrgtesdekiqsrinearkevemmnlydyvvvndevelaknriqci veaehlkrerveak
>d2j41a_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} ekgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyffktrdaf ealikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfpdalfif lappskevemmnlydyvvvndevelaknriqciveaehlkrerveak
Timeline for d2j41a_: