SCOPe 2.04: Domain d2j41a_: 2j41 A:

Lineage for d2j41a_ (2j41 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (79 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [187532] (4 PDB entries)

8. Domain d2j41a_: 2j41 A: [165860]
   automated match to d1s96a_
   complexed with 5gp, k, so4

Details for d2j41a_

PDB Entry: 2j41, 1.9 Å

PDB Description: crystal structure of staphylococcus aureus guanylate monophosphate kinase

PDB Compounds: (A:) Guanylate kinase

SCOPe Domain Sequences for d2j41a_:

Sequence, based on SEQRES records:

>d2j41a_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ekgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyffktrdaf
ealikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfpdalfif
lappslehlrerlvgrgtesdekiqsrinearkevemmnlydyvvvndevelaknriqci
veaehlkrerveak

Sequence, based on observed residues (ATOM records):

>d2j41a_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ekgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyffktrdaf
ealikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfpdalfif
lappskevemmnlydyvvvndevelaknriqciveaehlkrerveak

Timeline for d2j41a_:

• d2j41a_ first appeared in SCOPe 2.01
  
• d2j41a_ appears in SCOPe 2.03
  
• d2j41a_ appears in SCOPe 2.05
  
• d2j41a_ appears in the current release, SCOPe 2.08