Lineage for d2j41a_ (2j41 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872848Species Staphylococcus aureus [TaxId:1280] [187532] (5 PDB entries)
  8. 2872853Domain d2j41a_: 2j41 A: [165860]
    automated match to d1s96a_
    complexed with 5gp, k, so4

Details for d2j41a_

PDB Entry: 2j41 (more details), 1.9 Å

PDB Description: crystal structure of staphylococcus aureus guanylate monophosphate kinase
PDB Compounds: (A:) Guanylate kinase

SCOPe Domain Sequences for d2j41a_:

Sequence, based on SEQRES records: (download)

>d2j41a_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ekgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyffktrdaf
ealikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfpdalfif
lappslehlrerlvgrgtesdekiqsrinearkevemmnlydyvvvndevelaknriqci
veaehlkrerveak

Sequence, based on observed residues (ATOM records): (download)

>d2j41a_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ekgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyffktrdaf
ealikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfpdalfif
lappskevemmnlydyvvvndevelaknriqciveaehlkrerveak

SCOPe Domain Coordinates for d2j41a_:

Click to download the PDB-style file with coordinates for d2j41a_.
(The format of our PDB-style files is described here.)

Timeline for d2j41a_: