SCOPe 2.07: Domain d1a7da_: 1a7d A:

Lineage for d1a7da_ (1a7d A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.4: Hemerythrin-like [47188] (1 family)

5. Family a.24.4.1: Hemerythrin-like [47189] (2 proteins)
   Iron-binding proteins

6. Protein Myohemerythin [47193] (1 species)

7. Species Sipunculan worm (Themiste zostericola) [TaxId:6437] [47194] (3 PDB entries)

8. Domain d1a7da_: 1a7d A: [16582]
   complexed with cfo, cl

Details for d1a7da_

PDB Entry: 1a7d, 1.8 Å

PDB Description: chloromet myohemerythrin from themiste zostericola

PDB Compounds: (A:) myohemerythrin

SCOPe Domain Sequences for d1a7da_:

Sequence; same for both SEQRES and ATOM records:

>d1a7da_ a.24.4.1 (A:) Myohemerythin {Sipunculan worm (Themiste zostericola) [TaxId: 6437]}
gweipepyvwdesfrvfyeqldeehkkifkgifdcirdnsapnlatlvkvttnhftheea
mmdaakysevvphkkmhkdflekigglsapvdaknvdyckewlvnhikgtdfkykgkl

Timeline for d1a7da_:

• d1a7da_ first appeared (with stable ids) in SCOP 1.55, called d1a7d__
  
• d1a7da_ appears in SCOPe 2.06
  
• d1a7da_ appears in the current release, SCOPe 2.08