Lineage for d2j0ia_ (2j0i A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1044054Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1044055Protein automated matches [190417] (3 species)
    not a true protein
  7. 1044070Species Human (Homo sapiens) [TaxId:9606] [187294] (40 PDB entries)
  8. 1044071Domain d2j0ia_: 2j0i A: [165789]
    automated match to d1f3mc_
    complexed with edo

Details for d2j0ia_

PDB Entry: 2j0i (more details), 1.6 Å

PDB Description: crystal structure of the human p21-activated kinase 4
PDB Compounds: (A:) serine/threonine-protein kinase pak 4

SCOPe Domain Sequences for d2j0ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0ia_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sheqfraalqlvvdpgdprsyldnfikigegstgivciatvrssgklvavkkmdlrkqqr
rellfnevvimrdyqhenvvemynsylvgdelwvvmefleggaltdivthtrmneeqiaa
vclavlqalsvlhaqgvihrdiksdsillthdgrvklsdfgfcaqvskevprrkslvgtp
ywmapelisrlpygpevdiwslgimviemvdgeppyfnepplkamkmirdnlpprlknlh
kvspslkgfldrllvrdpaqrataaellkhpflakagppasivplmrqnr

SCOPe Domain Coordinates for d2j0ia_:

Click to download the PDB-style file with coordinates for d2j0ia_.
(The format of our PDB-style files is described here.)

Timeline for d2j0ia_: