Lineage for d2ii7c_ (2ii7 C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1564788Fold b.123: Hypothetical protein TM1070 [89231] (1 superfamily)
    sandwich; 8 strands in 2 sheets; jelly-roll
  4. 1564789Superfamily b.123.1: Hypothetical protein TM1070 [89232] (2 families) (S)
  5. 1564797Family b.123.1.0: automated matches [191462] (1 protein)
    not a true family
  6. 1564798Protein automated matches [190713] (1 species)
    not a true protein
  7. 1564799Species Anabaena sp. [TaxId:1167] [187862] (4 PDB entries)
  8. 1564815Domain d2ii7c_: 2ii7 C: [165557]
    automated match to d1nc7b_

Details for d2ii7c_

PDB Entry: 2ii7 (more details), 2.8 Å

PDB Description: Anabaena sensory rhodopsin transducer
PDB Compounds: (C:) Anabaena sensory rhodopsin transducer protein

SCOPe Domain Sequences for d2ii7c_:

Sequence, based on SEQRES records: (download)

>d2ii7c_ b.123.1.0 (C:) automated matches {Anabaena sp. [TaxId: 1167]}
slsigrtcwaiaegyippygngpepqfishetvcilnagdedahveitiyysdkepvgpy
rltvparrtkhvrfndlndpapiphdtdfasviqsnvpivvqhtrldsrqaenallstia

Sequence, based on observed residues (ATOM records): (download)

>d2ii7c_ b.123.1.0 (C:) automated matches {Anabaena sp. [TaxId: 1167]}
slsigrtcwaiaegyippshetvcilnagdedahveitiyysdkepvgpyrltvparrtk
hvrfndlndpapiphdtdfasviqsnvpivvqhtrldsrqaenallstia

SCOPe Domain Coordinates for d2ii7c_:

Click to download the PDB-style file with coordinates for d2ii7c_.
(The format of our PDB-style files is described here.)

Timeline for d2ii7c_: