Class b: All beta proteins [48724] (176 folds) |
Fold b.123: Hypothetical protein TM1070 [89231] (1 superfamily) sandwich; 8 strands in 2 sheets; jelly-roll |
Superfamily b.123.1: Hypothetical protein TM1070 [89232] (2 families) |
Family b.123.1.0: automated matches [191462] (1 protein) not a true family |
Protein automated matches [190713] (1 species) not a true protein |
Species Anabaena sp. [TaxId:1167] [187862] (4 PDB entries) |
Domain d2ii7b_: 2ii7 B: [165556] automated match to d1nc7b_ |
PDB Entry: 2ii7 (more details), 2.8 Å
SCOPe Domain Sequences for d2ii7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ii7b_ b.123.1.0 (B:) automated matches {Anabaena sp. [TaxId: 1167]} lsigrtcwaiaegyippygngpepqfishetvcilnagdedahveitiyysdkepvgpyr ltvparrtkhvrfndlndpapiphdtdfasviqsnvpivvqhtrldsrqaenall
Timeline for d2ii7b_: