SCOPe 2.08: Domain d2ihcb1: 2ihc B:7-120

Lineage for d2ihcb1 (2ihc B:7-120)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (54 PDB entries)

8. Domain d2ihcb1: 2ihc B:7-120 [165545]
   Other proteins in same PDB: d2ihcb2, d2ihcc2
   automated match to d1r28a_

Details for d2ihcb1

PDB Entry: 2ihc, 2.44 Å

PDB Description: Crystal structure of the bric-a-brac (BTB) domain of human BACH1

PDB Compounds: (B:) Transcription regulator protein BACH1

SCOPe Domain Sequences for d2ihcb1:

Sequence, based on SEQRES records:

>d2ihcb1 d.42.1.0 (B:7-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svfayessvhstnvllslndqrkkdvlcdvtifvegqrfrahrsvlaacssyfhsrivgq
adgelnitlpeevtvkgfepliqfaytaklilskenvdevckcveflsvhniee

Sequence, based on observed residues (ATOM records):

>d2ihcb1 d.42.1.0 (B:7-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svfayessvhstnvllslndqrkkdvlcdvtifvegqrfrahrsvlaacssyfhsrivgq
elnitlpeevtvkgfepliqfaytaklilskenvdevckcveflsvhniee

Timeline for d2ihcb1:

• d2ihcb1 first appeared in SCOPe 2.01, called d2ihcb_
  
• d2ihcb1 appears in SCOPe 2.07