Lineage for d2ihcb1 (2ihc B:7-120)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2169177Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2169178Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2169402Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2169403Protein automated matches [190710] (3 species)
    not a true protein
  7. 2169404Species Human (Homo sapiens) [TaxId:9606] [187857] (38 PDB entries)
  8. 2169449Domain d2ihcb1: 2ihc B:7-120 [165545]
    Other proteins in same PDB: d2ihcb2, d2ihcc2
    automated match to d1r28a_

Details for d2ihcb1

PDB Entry: 2ihc (more details), 2.44 Å

PDB Description: Crystal structure of the bric-a-brac (BTB) domain of human BACH1
PDB Compounds: (B:) Transcription regulator protein BACH1

SCOPe Domain Sequences for d2ihcb1:

Sequence, based on SEQRES records: (download)

>d2ihcb1 d.42.1.0 (B:7-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svfayessvhstnvllslndqrkkdvlcdvtifvegqrfrahrsvlaacssyfhsrivgq
adgelnitlpeevtvkgfepliqfaytaklilskenvdevckcveflsvhniee

Sequence, based on observed residues (ATOM records): (download)

>d2ihcb1 d.42.1.0 (B:7-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svfayessvhstnvllslndqrkkdvlcdvtifvegqrfrahrsvlaacssyfhsrivgq
elnitlpeevtvkgfepliqfaytaklilskenvdevckcveflsvhniee

SCOPe Domain Coordinates for d2ihcb1:

Click to download the PDB-style file with coordinates for d2ihcb1.
(The format of our PDB-style files is described here.)

Timeline for d2ihcb1: