PDB entry 2ihc

View 2ihc on RCSB PDB site
Description: Crystal structure of the bric-a-brac (BTB) domain of human BACH1
Class: transcription
Keywords: BACH1, bric-a-brac domain,transcription factor, protein-protein interaction, cap'n'collar type of basic region leucine zipper factor family, Structural Genomics, Structural Genomics Consortium, SGC, TRANSCRIPTION
Deposited on 2006-09-26, released 2006-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.248
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription regulator protein BACH1
    Species: Homo sapiens [TaxId:9606]
    Gene: BACH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ihca_
  • Chain 'B':
    Compound: Transcription regulator protein BACH1
    Species: Homo sapiens [TaxId:9606]
    Gene: BACH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14867 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d2ihcb1, d2ihcb2
  • Chain 'C':
    Compound: Transcription regulator protein BACH1
    Species: Homo sapiens [TaxId:9606]
    Gene: BACH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14867 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d2ihcc1, d2ihcc2
  • Chain 'D':
    Compound: Transcription regulator protein BACH1
    Species: Homo sapiens [TaxId:9606]
    Gene: BACH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ihcd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ihcA (A:)
    smsvfayessvhstnvllslndqrkkdvlcdvtifvegqrfrahrsvlaacssyfhsriv
    gqadgelnitlpeevtvkgfepliqfaytaklilskenvdevckcveflsvhnieescfq
    flkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ihcA (A:)
    svfayessvhstnvllslndqrkkdvlcdvtifvegqrfrahrsvlaacssyfhsrivgq
    elnitlpeevtvkgfepliqfaytaklilskenvdevckcveflsvhnieescfqfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ihcB (B:)
    smsvfayessvhstnvllslndqrkkdvlcdvtifvegqrfrahrsvlaacssyfhsriv
    gqadgelnitlpeevtvkgfepliqfaytaklilskenvdevckcveflsvhnieescfq
    flkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ihcB (B:)
    smsvfayessvhstnvllslndqrkkdvlcdvtifvegqrfrahrsvlaacssyfhsriv
    gqelnitlpeevtvkgfepliqfaytaklilskenvdevckcveflsvhniee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ihcC (C:)
    smsvfayessvhstnvllslndqrkkdvlcdvtifvegqrfrahrsvlaacssyfhsriv
    gqadgelnitlpeevtvkgfepliqfaytaklilskenvdevckcveflsvhnieescfq
    flkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ihcC (C:)
    msvfayessvhstnvllslndqrkkdvlcdvtifvegqrfrahrsvlaacssyfhsrive
    lnitlpeevtvkgfepliqfaytaklilskenvdevckcveflsvhnieescfqflk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ihcD (D:)
    smsvfayessvhstnvllslndqrkkdvlcdvtifvegqrfrahrsvlaacssyfhsriv
    gqadgelnitlpeevtvkgfepliqfaytaklilskenvdevckcveflsvhnieescfq
    flkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ihcD (D:)
    svfayessvhstnvllslndqrkkdvlcdvtifvegqrfrahrsvlaacssyfhsrivln
    itlpeevtvkgfepliqfaytaklilskenvdevckcveflsvhnieescfqflk