SCOPe 2.08: Domain d2ccyb_: 2ccy B:

Lineage for d2ccyb_ (2ccy B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
   automatically mapped to Pfam PF01322

6. Protein Cytochrome c' [47180] (9 species)

7. Species Rhodospirillum molischianum [TaxId:1083] [47181] (1 PDB entry)

8. Domain d2ccyb_: 2ccy B: [16545]
   complexed with hec

Details for d2ccyb_

PDB Entry: 2ccy, 1.67 Å

PDB Description: structure of ferricytochrome c(prime) from rhodospirillum molischianum at 1.67 angstroms resolution

PDB Compounds: (B:) cytochrome c

SCOPe Domain Sequences for d2ccyb_:

Sequence; same for both SEQRES and ATOM records:

>d2ccyb_ a.24.3.2 (B:) Cytochrome c' {Rhodospirillum molischianum [TaxId: 1083]}
qskpedllklrqglmqtlksqwvpiagfaagkadlpadaaqraenmamvaklapigwakg
tealpngetkpeafgsksaeflegwkalatestklaaaakagpdalkaqaaatgkvckac
heefkqd

Timeline for d2ccyb_:

• d2ccyb_ first appeared (with stable ids) in SCOP 1.55
  
• d2ccyb_ appears in SCOPe 2.07