Lineage for d2i2qa_ (2i2q A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1215401Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1215402Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 1215516Family d.109.1.2: Cofilin-like [55762] (8 proteins)
  6. 1215568Protein automated matches [190045] (3 species)
    not a true protein
  7. 1215569Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [187836] (1 PDB entry)
  8. 1215570Domain d2i2qa_: 2i2q A: [165374]
    automated match to d1cfya_
    complexed with edo, lda, so4

Details for d2i2qa_

PDB Entry: 2i2q (more details), 1.72 Å

PDB Description: fission yeast cofilin
PDB Compounds: (A:) cofilin

SCOPe Domain Sequences for d2i2qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2qa_ d.109.1.2 (A:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
sfsgvkvspecleafqelklgkslryvvfkmndtkteivvekkstdkdfdtflgdlpekd
cryaiydfefnlgegvrnkiifiswspdvapikskmvyssskdtlrraftgigtdiqatd
fs

SCOPe Domain Coordinates for d2i2qa_:

Click to download the PDB-style file with coordinates for d2i2qa_.
(The format of our PDB-style files is described here.)

Timeline for d2i2qa_: