Lineage for d2htye_ (2hty E:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 959648Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 959649Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 959937Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 959938Protein automated matches [190692] (4 species)
    not a true protein
  7. 959942Species Influenza A virus [TaxId:11320] [188445] (16 PDB entries)
  8. 959958Domain d2htye_: 2hty E: [165255]
    automated match to d1a14n_
    complexed with ca, nag, ndg

Details for d2htye_

PDB Entry: 2hty (more details), 2.5 Å

PDB Description: n1 neuraminidase
PDB Compounds: (E:) Neuraminidase

SCOPe Domain Sequences for d2htye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2htye_ b.68.1.0 (E:) automated matches {Influenza A virus [TaxId: 11320]}
vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
isfcgvnsdtvgwswpdgaelpfti

SCOPe Domain Coordinates for d2htye_:

Click to download the PDB-style file with coordinates for d2htye_.
(The format of our PDB-style files is described here.)

Timeline for d2htye_: