Lineage for d2hpwa_ (2hpw A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2939778Protein Green fluorescent protein, GFP [54513] (6 species)
  7. 2939781Species Clytia gregaria [TaxId:27801] [188531] (1 PDB entry)
  8. 2939782Domain d2hpwa_: 2hpw A: [165204]
    automated match to d1emca_

Details for d2hpwa_

PDB Entry: 2hpw (more details), 1.55 Å

PDB Description: Green fluorescent protein from Clytia gregaria
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d2hpwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hpwa_ d.22.1.1 (A:) Green fluorescent protein, GFP {Clytia gregaria [TaxId: 27801]}
tegaklfekeipyitelegdvegmkfiikgegtgdattgtikakyicttgdlpvpwatil
sslsygvfcfakyprhiadffkstqpdgysqdriisfdndgqydvkakvtyengtlynrv
tvkgtgfksngnilgmrvlyhspphavyilpdrknggmkieynkafdvmggghqmarhaq
fnkplgaweedyplyhhltvwtsfgkdpdddetdhltivevikavdletyr

SCOPe Domain Coordinates for d2hpwa_:

Click to download the PDB-style file with coordinates for d2hpwa_.
(The format of our PDB-style files is described here.)

Timeline for d2hpwa_: