Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein Green fluorescent protein, GFP [54513] (6 species) |
Species Clytia gregaria [TaxId:27801] [188531] (1 PDB entry) |
Domain d2hpwa_: 2hpw A: [165204] automated match to d1emca_ |
PDB Entry: 2hpw (more details), 1.55 Å
SCOPe Domain Sequences for d2hpwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hpwa_ d.22.1.1 (A:) Green fluorescent protein, GFP {Clytia gregaria [TaxId: 27801]} tegaklfekeipyitelegdvegmkfiikgegtgdattgtikakyicttgdlpvpwatil sslsygvfcfakyprhiadffkstqpdgysqdriisfdndgqydvkakvtyengtlynrv tvkgtgfksngnilgmrvlyhspphavyilpdrknggmkieynkafdvmggghqmarhaq fnkplgaweedyplyhhltvwtsfgkdpdddetdhltivevikavdletyr
Timeline for d2hpwa_: