Lineage for d2hp5b1 (2hp5 B:20-264)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013280Protein Class D beta-lactamase [56622] (4 species)
  7. 3013294Species Pseudomonas aeruginosa, OXA-10 [TaxId:287] [56623] (36 PDB entries)
  8. 3013378Domain d2hp5b1: 2hp5 B:20-264 [165194]
    Other proteins in same PDB: d2hp5a2, d2hp5b2
    automated match to d1k4fb_
    complexed with co, so4; mutant

Details for d2hp5b1

PDB Entry: 2hp5 (more details), 2.7 Å

PDB Description: crystal structure of the oxa-10 w154g mutant at ph 7.0
PDB Compounds: (B:) Beta-lactamase PSE-2

SCOPe Domain Sequences for d2hp5b1:

Sequence, based on SEQRES records: (download)

>d2hp5b1 e.3.1.1 (B:20-264) Class D beta-lactamase {Pseudomonas aeruginosa, OXA-10 [TaxId: 287]}
gsitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigle
tgviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkf
sygnqnisggidkfglegqlrisavnqvefleslylnklsaskenqlivkealvteaape
ylvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkime
segii

Sequence, based on observed residues (ATOM records): (download)

>d2hp5b1 e.3.1.1 (B:20-264) Class D beta-lactamase {Pseudomonas aeruginosa, OXA-10 [TaxId: 287]}
gsitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigle
tgviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkf
sygnqnglegqlrisavnqvefleslylnklsaskenqlivkealvteaapeylvhsktg
fsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimesegii

SCOPe Domain Coordinates for d2hp5b1:

Click to download the PDB-style file with coordinates for d2hp5b1.
(The format of our PDB-style files is described here.)

Timeline for d2hp5b1: