Lineage for d1mhzg_ (1mhz G:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1083160Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 1083191Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
  5. 1083192Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 1083193Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 1083248Species Methylosinus trichosporium [TaxId:426] [47156] (2 PDB entries)
  8. 1083250Domain d1mhzg_: 1mhz G: [16519]
    Other proteins in same PDB: d1mhzb_, d1mhzd_
    complexed with fe

Details for d1mhzg_

PDB Entry: 1mhz (more details), 2.7 Å

PDB Description: methane monooxygenase hydroxylase
PDB Compounds: (G:) methane monooxygenase hydroxylase

SCOPe Domain Sequences for d1mhzg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhzg_ a.23.3.1 (G:) Methane monooxygenase hydrolase, gamma subunit {Methylosinus trichosporium [TaxId: 426]}
akrepihdnsirteweakiakltsvdqatkfiqdfrlaytspfrksydidvdyqyierki
eeklsvlkteklpvadlitkattgedaaaveatwiakikaakskyeaeaihiefrqlykp
pvlpvnvflrtdaalgtvlmeirntdyygtpleglrkergvkvlhlq

SCOPe Domain Coordinates for d1mhzg_:

Click to download the PDB-style file with coordinates for d1mhzg_.
(The format of our PDB-style files is described here.)

Timeline for d1mhzg_: