SCOPe 2.08: Domain d1mhzg_: 1mhz G:

Lineage for d1mhzg_ (1mhz G:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold
   automatically mapped to Pfam PF02964

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylosinus trichosporium [TaxId:426] [47156] (2 PDB entries)

8. Domain d1mhzg_: 1mhz G: [16519]
   Other proteins in same PDB: d1mhzb_, d1mhzd_
   complexed with fe

Details for d1mhzg_

PDB Entry: 1mhz, 2.7 Å

PDB Description: methane monooxygenase hydroxylase

PDB Compounds: (G:) methane monooxygenase hydroxylase

SCOPe Domain Sequences for d1mhzg_:

Sequence; same for both SEQRES and ATOM records:

>d1mhzg_ a.23.3.1 (G:) Methane monooxygenase hydrolase, gamma subunit {Methylosinus trichosporium [TaxId: 426]}
akrepihdnsirteweakiakltsvdqatkfiqdfrlaytspfrksydidvdyqyierki
eeklsvlkteklpvadlitkattgedaaaveatwiakikaakskyeaeaihiefrqlykp
pvlpvnvflrtdaalgtvlmeirntdyygtpleglrkergvkvlhlq

Timeline for d1mhzg_:

• d1mhzg_ first appeared (with stable ids) in SCOP 1.55
  
• d1mhzg_ appears in SCOPe 2.07