SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1mhzg_ (1mhz G:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987222Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 1987255Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
    automatically mapped to Pfam PF02964
  5. 1987256Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 1987257Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 1987315Species Methylosinus trichosporium [TaxId:426] [47156] (2 PDB entries)
  8. 1987317Domain d1mhzg_: 1mhz G: [16519]
    Other proteins in same PDB: d1mhzb_, d1mhzd_
    complexed with fe

Details for d1mhzg_

PDB Entry: 1mhz (more details), 2.7 Å

PDB Description: methane monooxygenase hydroxylase
PDB Compounds: (G:) methane monooxygenase hydroxylase

SCOPe Domain Sequences for d1mhzg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhzg_ a.23.3.1 (G:) Methane monooxygenase hydrolase, gamma subunit {Methylosinus trichosporium [TaxId: 426]}
akrepihdnsirteweakiakltsvdqatkfiqdfrlaytspfrksydidvdyqyierki
eeklsvlkteklpvadlitkattgedaaaveatwiakikaakskyeaeaihiefrqlykp
pvlpvnvflrtdaalgtvlmeirntdyygtpleglrkergvkvlhlq

SCOPe Domain Coordinates for d1mhzg_:

Click to download the PDB-style file with coordinates for d1mhzg_.
(The format of our PDB-style files is described here.)

Timeline for d1mhzg_: