SCOPe 2.06: Domain d2hotb_: 2hot B:

Lineage for d2hotb_ (2hot B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein Engrailed Homeodomain [46691] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46692] (12 PDB entries)

8. Domain d2hotb_: 2hot B: [165182]
   automated match to d1ztra1
   protein/DNA complex; complexed with gol, p2o

Details for d2hotb_

PDB Entry: 2hot, 2.19 Å

PDB Description: phage selected homeodomain bound to modified dna

PDB Compounds: (B:) Segmentation polarity homeobox protein engrailed

SCOPe Domain Sequences for d2hotb_:

Sequence; same for both SEQRES and ATOM records:

>d2hotb_ a.4.1.1 (B:) Engrailed Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
krprtafsseqlarlkrefnenrylterrrqqlsselglneaqvkgwfknmrakikks

Timeline for d2hotb_:

• d2hotb_ first appeared in SCOPe 2.01
  
• d2hotb_ appears in SCOPe 2.05
  
• d2hotb_ appears in SCOPe 2.07
  
• d2hotb_ appears in the current release, SCOPe 2.08