Lineage for d2hkmh_ (2hkm H:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1243277Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1243278Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 1243361Family g.21.1.0: automated matches [191380] (1 protein)
    not a true family
  6. 1243362Protein automated matches [190474] (1 species)
    not a true protein
  7. 1243363Species Alcaligenes faecalis [TaxId:511] [187398] (27 PDB entries)
  8. 1243395Domain d2hkmh_: 2hkm H: [165133]
    automated match to d1mg2b_
    complexed with pea

Details for d2hkmh_

PDB Entry: 2hkm (more details), 1.5 Å

PDB Description: Crystal structure of the Schiff base intermediate in the reductive half-reaction of aromatic amine dehydrogenase (AADH) with phenylethylamine.
PDB Compounds: (H:) Aromatic amine dehydrogenase

SCOPe Domain Sequences for d2hkmh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hkmh_ g.21.1.0 (H:) automated matches {Alcaligenes faecalis [TaxId: 511]}
slnpdlanedevnscdywrhcavdgflcsccggttttcppgstpspiswigtchnphdgk
dylisyhdccgktacgrcqcntqtrerpgyefflhndvnwcmanenstfhcttsvlvgla

SCOPe Domain Coordinates for d2hkmh_:

Click to download the PDB-style file with coordinates for d2hkmh_.
(The format of our PDB-style files is described here.)

Timeline for d2hkmh_: