SCOPe 2.04: Domain d2h8qc_: 2h8q C:

Lineage for d2h8qc_ (2h8q C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Red fluorescent protein (fp583 or dsred(clontech)) [54515] (1 species)

7. Species Coral (Discosoma sp.) [TaxId:86600] [54516] (3 PDB entries)

8. Domain d2h8qc_: 2h8q C: [165012]
   automated match to d1g7ka_
   mutant

Details for d2h8qc_

PDB Entry: 2h8q, 2 Å

PDB Description: crystal structure of a redshifted mutant (k83m) of the red fluorescent protein drfp583/dsred

PDB Compounds: (C:) red fluorescent protein drfp583

SCOPe Domain Sequences for d2h8qc_:

Sequence; same for both SEQRES and ATOM records:

>d2h8qc_ d.22.1.1 (C:) Red fluorescent protein (fp583 or dsred(clontech)) {Coral (Discosoma sp.) [TaxId: 86600]}
vikefmrfkvrmegtvnghefeiegegegrpyeghntvklkvtkggplpfawdilspqfq
ygskvyvkhpadipdymklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig
vnfpsdgpvmqkktmgweasterlyprdgvlkgeihkalklkdgghylvefksiymakkp
vqlpgyyyvdsklditshnedytiveqyertegrhhlfl

Timeline for d2h8qc_:

• d2h8qc_ first appeared in SCOPe 2.01
  
• d2h8qc_ appears in SCOPe 2.03
  
• d2h8qc_ appears in SCOPe 2.05
  
• d2h8qc_ appears in the current release, SCOPe 2.08