Lineage for d2h8qc_ (2h8q C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940208Protein Red fluorescent protein (fp583 or dsred(clontech)) [54515] (1 species)
  7. 2940209Species Coral (Discosoma sp.) [TaxId:86600] [54516] (3 PDB entries)
  8. 2940220Domain d2h8qc_: 2h8q C: [165012]
    automated match to d1g7ka_
    mutant

Details for d2h8qc_

PDB Entry: 2h8q (more details), 2 Å

PDB Description: crystal structure of a redshifted mutant (k83m) of the red fluorescent protein drfp583/dsred
PDB Compounds: (C:) red fluorescent protein drfp583

SCOPe Domain Sequences for d2h8qc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h8qc_ d.22.1.1 (C:) Red fluorescent protein (fp583 or dsred(clontech)) {Coral (Discosoma sp.) [TaxId: 86600]}
vikefmrfkvrmegtvnghefeiegegegrpyeghntvklkvtkggplpfawdilspqfq
ygskvyvkhpadipdymklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig
vnfpsdgpvmqkktmgweasterlyprdgvlkgeihkalklkdgghylvefksiymakkp
vqlpgyyyvdsklditshnedytiveqyertegrhhlfl

SCOPe Domain Coordinates for d2h8qc_:

Click to download the PDB-style file with coordinates for d2h8qc_.
(The format of our PDB-style files is described here.)

Timeline for d2h8qc_: