Lineage for d1bh9b_ (1bh9 B:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151058Fold a.22: Histone-fold [47112] (1 superfamily)
  4. 151059Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 151140Family a.22.1.3: TBP-associated factors, TAFs [47134] (6 proteins)
  6. 151151Protein TAF(II)28 [47141] (1 species)
  7. 151152Species Human (Homo sapiens) [TaxId:9606] [47142] (2 PDB entries)
  8. 151153Domain d1bh9b_: 1bh9 B: [16485]
    Other proteins in same PDB: d1bh9a_

Details for d1bh9b_

PDB Entry: 1bh9 (more details), 2.6 Å

PDB Description: htafii18/htafii28 heterodimer crystal structure with bound pcmbs

SCOP Domain Sequences for d1bh9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bh9b_ a.22.1.3 (B:) TAF(II)28 {Human (Homo sapiens)}
fseeqlnryemyrrsafpkaaikrliqsitgtsvsqnvviamsgiskvfvgevveealdv
cekwgempplqpkhmreavrrlkskgqip

SCOP Domain Coordinates for d1bh9b_:

Click to download the PDB-style file with coordinates for d1bh9b_.
(The format of our PDB-style files is described here.)

Timeline for d1bh9b_:

151153
d1bh9b_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1bh9a_