SCOPe 2.08: Domain d1bh9b_: 1bh9 B:

Lineage for d1bh9b_ (1bh9 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)

6. Protein TAF(II)28 [47141] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47142] (2 PDB entries)

8. Domain d1bh9b_: 1bh9 B: [16485]
   Other proteins in same PDB: d1bh9a_
   complexed with pmb

Details for d1bh9b_

PDB Entry: 1bh9, 2.6 Å

PDB Description: htafii18/htafii28 heterodimer crystal structure with bound pcmbs

PDB Compounds: (B:) tafii28

SCOPe Domain Sequences for d1bh9b_:

Sequence; same for both SEQRES and ATOM records:

>d1bh9b_ a.22.1.3 (B:) TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]}
fseeqlnryemyrrsafpkaaikrliqsitgtsvsqnvviamsgiskvfvgevveealdv
cekwgempplqpkhmreavrrlkskgqip

Timeline for d1bh9b_:

• d1bh9b_ first appeared (with stable ids) in SCOP 1.55
  
• d1bh9b_ appears in SCOPe 2.07